Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-90986
Key Product Details
Source
E. coli
Tag
His (N-Term), Avi-tag
Conjugate
Unconjugated
Applications
ELISA, SDS-PAGE
Product Specifications
Description
A full length recombinant protein with a N-Terminal His-tag and Avi epitope tag and corresponding to the amino acids sequence of (1-75) of the SARS-CoV-2 envelope protein
Source: E.coli
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV (Accession #YP_009724392.1)
Purity
>95%, by SDS-PAGE
Endotoxin Level
< 0.1 EU/ug of the protein by LAL method.
Predicted Molecular Mass
11.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Application Notes
Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Envelope at 2ug/mL (100 uL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images
ELISA: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986]
ELISA: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986] - Immobilized Recombinant SARS-CoV-2 Envelope at 2ug/mL (100 uL/well) can bind Recombinant SARS-CoV-2 Nucleocapsid with a linear range of 1.2-41.1 ng/mL.SDS-PAGE: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986]
SDS-Page: Recombinant SARS-CoV-2 Envelope (Avi Epitope Tag) His (N-Term) Avi-tag Protein [NBP2-90986] - Recombinant SARS-CoV-2 Envelope Protein with His and Avi tag was determined by SDS-PAGE with Coomassie Blue, showing a band at 12 kDa.Formulation, Preparation and Storage
NBP2-90986
| Formulation | Supplied as a 0.22 um filtered solution in 20mM Tris, 250mM NaCl, 0.5%TritonX-100, pH 8.0. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20 to -70C. Avoid freeze-thaw cycles. |
Background: SARS-CoV-2 Envelope
References
1. Malik Y. A. (2020). Properties of Coronavirus and SARS-CoV-2. The Malaysian Journal of Pathology.
2. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The Protein Journal. https://doi.org/10.1007/s10930-020-09901-4
3. Uniprot (P0DTC4)
4. J Alsaadi, E. A., & Jones, I. M. (2019). Membrane binding proteins of coronaviruses. Future Virology. https://doi.org/10.2217/fvl-2018-0144
Alternate Names
2019-nCoV Envelope protein, COVID-19 Envelope protein, E Protein, Envelope, Human Coronavirus Envelope protein, SARSCoV2, SARS-CoV-2 E protein, SARSCoV2 Envelope protein, SARS-CoV-2 Envelope protein, Severe acute respiratory syndrome 2 Envelope Protein
Gene Symbol
E
Additional SARS-CoV-2 Envelope Products
Product Specific Notices
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...