Recombinant Human Prodynorphin/PDYN GST (N-Term) Protein

Name: Recombinant Human Prodynorphin/PDYN GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00005173-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00005173-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Accession #

NP_077722

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

View all Prodynorphin/PDYN Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 147-254 of Prodynorphin/PDYN

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGEGDGDSMGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Prodynorphin/PDYN GST (N-Term) Protein

SDS-PAGE: Recombinant Human Prodynorphin/PDYN GST (N-Term) Protein [H00005173-Q01]

SDS-Page: Recombinant Human Dynorphin Protein [H00005173-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00005173-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Prodynorphin/PDYN

The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2010]

Alternate Names

ADCA, Beta-neoendorphin-dynorphin, leu-enkephalin, leumorphin, neoendorphin-dynorphin-enkephalin prepropeptide, PENKB, preprodynorphin, preproenkephalin B, proenkephalin-B, rimorphin, SCA23

Gene Symbol

PDYN

UniProt

NP_077722 (Human)

Additional Prodynorphin/PDYN Products

Product Documents for Recombinant Human Prodynorphin/PDYN GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Prodynorphin/PDYN GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews