Nephronectin Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83990PEP
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: RQCVNTFGSYICKCHKGFDLMYIGGKYQCHDIDECSLGQYQCSSFARCYNVRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVPKGNGTILKGDTGNNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPK
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP1-83990PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Nephronectin
Nephronectin, also called POEM (preosteoblast EGF repeat protein with MAM domain) is a 70 - 90 kDa extracellular matrix protein that is a ligand for integrin alpha8beta1. Nephronectin is most highly expressed in developing endocrine organs such as parathyroid, thyroid, hypophysis and pineal organ, and around developing bone, teeth, and muscle. Pre-osteoblast cells produce nephronectin, but downregulate it as they differentiate. It is also expressed in the Wolffian duct and ureteric bud basement membranes in the developing kidney, where it is colocalizes, and forms an in vivo complex with integrin alpha8beta1. Since deletion of integrin alpha8beta1 results in renal agenesis, nephronectin has been proposed to be a critical integrin alpha8beta1 ligand during nephrogenesis.
The 561 aa mouse nephronectin (isoform B) contains a 19 amino acid (aa) signal sequence, a matrilin-type vWA domain, two calcium-binding EGF-like domains, a potential N-linked glycosylation site, a pro/ser/thr-rich mucin-like region, an RGD integrin binding motif, and a MAM domain. These features are often present in matrix proteins that, like nephronectin, mediate cell adhesion and spreading. Isoform A includes a 17 aa insertion between aa # 58 and 59 that is missing in Nephronectin isoform B. Mouse nephronectin shows 88%, 92%, 85% and 77% aa identity with human, rat, cow and opossum nephronectin, respectively.
Alternate Names
Gene Symbol
Additional Nephronectin Products
Product Documents for Nephronectin Recombinant Protein Antigen
Product Specific Notices for Nephronectin Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.