Skip to main content

Recombinant Human NDUFA1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00004694-P02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00004694-P02-10ug
H00004694-P02-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-70 of Human NDUFA1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33.44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NDUFA1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human NDUFA1 GST (N-Term) Protein [H00004694-P02]

SDS-PAGE: Recombinant Human NDUFA1 GST (N-Term) Protein [H00004694-P02]

SDS-Page: Recombinant Human NDUFA1 Protein [H00004694-P02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004694-P02
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NDUFA1

The human NDUFA1 gene codes for an essential component of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. It has been noted that the N-terminal hydrophobic domain has the potential to be folded into an alpha-helix spanning the inner mitochondrial membrane with a C-terminal hydrophilic domain interacting with globular subunits of complex I. The highly conserved two-domain structure suggests that this feature is critical for the protein function and might act as an anchor for the NADH:ubiquinone oxidoreductase complex at the inner mitochondrial membrane. However, the NDUFA1 peptide is one of about 31 components of the "hydrophobic protein" (HP) fraction of complex I which is involved in proton translocation. Thus the NDUFA1 peptide may also participate in that function. [provided by RefSeq]

Alternate Names

CI-MWFEcomplex I MWFE subunit, Complex I-MWFE, MWFENADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1 (7.5kD, MWFE), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa, NADH oxidoreductase subunit MWFE, NADH:ubiquinone oxidoreductase (complex 1), NADH-ubiquinone oxidoreductase MWFE subunit, type I dehydrogenase, ZNF183

Gene Symbol

NDUFA1

Additional NDUFA1 Products

Product Documents for Recombinant Human NDUFA1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human NDUFA1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...