Skip to main content

LMX1b Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24958PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-24958PEP

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMX1b

Source: E.coli

Amino Acid Sequence: YEKEKDLLSSVSPDESDSVKSEDEDGDMKPAKGQGSQSKGSG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24958It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-24958PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LMX1b

LMX1B is a gene that codes for a protein with three isoforms, measuring 402, 395, and 406 amino acids in length with weights of approximately 45, 44, and 45 kDa respectively. LMX1B is necessary for the specification of dorsal limb fate. Current studies are being done on several diseases and disorders related to this gene including Meier-Gorlin syndrome, steroid-resistant nephrotic syndrome, sex reversal, attention deficit hyperactivity disorder, cleft lip/palate, familial Mediterranean fever, genitopatellar syndrome, major depressive disorder, nail dysplasia, short stature, heart block, and neuronitis. LMX1B has also been shown to have interactions with LDB1, TCF3, SSBP3, ALX4, and LDB2 in pathways such as the SIDS susceptibility pathway.

Alternate Names

LIM homeobox transcription factor 1, beta, LIM homeobox transcription factor 1-beta, LIM/homeobox protein 1.2, LIM/homeobox protein LMX1B, LMX1.2, LMX-1.2, MGC138325, MGC142051, NPS1

Gene Symbol

LMX1B

Additional LMX1b Products

Product Documents for LMX1b Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LMX1b Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...