Skip to main content

Recombinant Human Integrin alpha 2/CD49b GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003673-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00003673-Q01-10ug
H00003673-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence of (NP_002194.2) for Human Integrin alpha 2/CD49b

Source: Wheat Germ (in vitro)

Amino Acid Sequence: YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Integrin alpha 2/CD49b GST (N-Term) Protein

SDS-PAGE: Recombinant Human Integrin alpha 2/CD49b GST (N-Term) Protein [H00003673-Q01]

SDS-PAGE: Recombinant Human Integrin alpha 2/CD49b GST (N-Term) Protein [H00003673-Q01]

SDS-Page: Recombinant Human Integrin alpha 2/CD49b Protein [H00003673-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Formulation, Preparation and Storage

H00003673-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Integrin alpha 2/CD49b

Integrins are heterodimeric cell surface receptors composed of alpha and beta subunits, which mediate cell-cell and cell-extracellular matrix attachments. They are responsible for adhesion of platelets and other cells to collagens, modulation of collagen and collagenase gene expression, force generation and organization of newly synthesized extracellular matrix. Aberrant integrin expression has been found in many epithelial tumours. Changes in integrin expression have been shown to be important for the growth and early metastatic capacity of melanoma cells.

Alternate Names

CD49b, ITGA2, VLA-2 alpha

Gene Symbol

ITGA2

Additional Integrin alpha 2/CD49b Products

Product Documents for Recombinant Human Integrin alpha 2/CD49b GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Integrin alpha 2/CD49b GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...