IL-11R alpha Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24911PEP
Key Product Details
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-11R alpha
Source: E.coli
Amino Acid Sequence: RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
Purity
>80% by SDS-PAGE and Coomassie blue staining
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24911It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP3-24911PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: IL-11 R alpha
IL-11 Ra (Interleukin-11 receptor alpha) is a widely expressed transmembrane protein that associates with gp130 to form a functional receptor complex for the cytokine IL-11. gp130 also functions as a subunit in the receptors for Cardiotrophin-1, CNTF, IL-6, IL-27, IL-31, LIF, and Oncostatin M. IL-11 Ra plays a role in female reproduction and the survival of oligodendrocytes and colonic epithelial cells. It enhances osteoclast differentiation and bone remodeling but inhibits adipocyte differentiation. Soluble IL-11 Ra confers IL-11 responsiveness to cells expressing gp130, while in cells expressing transmembrane IL-11 Ra and gp130, soluble IL-11 Ra acts as an IL-11 antagonist.
Long Name
Interleukin 11 Receptor alpha
Alternate Names
IL-11Ra, IL11R alpha, IL11RA
Gene Symbol
IL11RA
Additional IL-11 R alpha Products
Product Documents for IL-11R alpha Recombinant Protein Antigen
Product Specific Notices for IL-11R alpha Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...