Skip to main content

Recombinant Human IgG3 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003502-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00003502-P01-10ug
H00003502-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-521 of Human IGHG3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEFGLSWVLLVVFLQGVQCEVQLVDSGGGLVQPGGSLRLSCAASGFIVSDHYVEWVRQAPGKGPEWVGCFRSKAHKSTTEYAASVKGRFTILRDDSKNSVHLQMNSLKTDDTAVYYCVRDLEGAGKYDWYFDIWGRGILVTVSSASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQFNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

83.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human IgG3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human IgG3 GST (N-Term) Protein [H00003502-P01]

SDS-PAGE: Recombinant Human IgG3 GST (N-Term) Protein [H00003502-P01]

SDS-Page: Recombinant Human IgG3 Protein [H00003502-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003502-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: IgG3

R&D Systems offers a range of secondary antibodies and controls for flow cytometry, immunohistochemistry, and Western blotting. We provide species-specific secondary antibodies that are available with a variety of conjugated labels.

Our NorthernLights fluorescent secondary antibodies are bright and resistant to photobleaching. We are currently offering secondary antibodies recognizing mouse, rat, goat, sheep, and rabbit IgG as well as chicken IgY. These reagents are available with three distinct excitation and emission maxima, making them ideal for multi-color fluorescence microscopy.

Long Name

Immunoglobulin G3

Alternate Names

DKFZp686H11213, FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, IgG3, immunoglobulin heavy constant gamma 3 (G3m marker), MGC45809

Gene Symbol

IGHG3

Additional IgG3 Products

Product Documents for Recombinant Human IgG3 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human IgG3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...