HDLBP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24896PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-24896PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all HDLBP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HDLBP

Source: E.coli

Amino Acid Sequence: LHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24896It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-24896PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HDLBP

HDL-binding protein 1 (HDLBP) is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel or to adipose tissue for energy storage. Triglycerides are broken down or hydrolyzed by the enzyme lipoprotein lipase (LpL). The triglyceride breakdown products are then taken up and used by cells. HDLBP is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of HDLBP.

Alternate Names

HBPFLJ16432, HDL-binding protein, high density lipoprotein binding protein, High density lipoprotein-binding protein, PRO2900, VGLvigilin

Gene Symbol

HDLBP

Additional HDLBP Products

Product Documents for HDLBP Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HDLBP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2026 Bio-Techne. All Rights Reserved.