Skip to main content

DDX41 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89297PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89297PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DDX41.

Source: E. coli

Amino Acid Sequence: MEESEPERRRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAEEEQQDSGSEPRGDEDDIPLGPQSNVSLLDQHQHL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89297.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89297PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DDX41

DDX41, also known as Probable ATP-dependent RNA helicase DDX41, is a 69.8 kDa, 622 amino acid protein that is involved in gene expression after transcription as a member of the DEAD box protein family. Current research is being conducted for diseases and disorders such as immunodeficiency, nephritis, tetanus, embryonal carcinoma, hepatitis, spinal muscular atrophy, lyme disease, and neuroblastoma. The protein is a part of the RNA processing pathway, where it interacts with NKAP, CDC5L, CCNB1, USP36, and SNW1.

Alternate Names

ABSDEAD-box protein abstrakt, DEAD (Asp-Glu-Ala-Asp) box polypeptide 41, DEAD box protein 41, DEAD box protein abstrakt homolog, EC 3.6.1, EC 3.6.4.13,2900024F02Rik, MGC8828, probable ATP-dependent RNA helicase DDX41, putative RNA helicase

Gene Symbol

DDX41

Additional DDX41 Products

Product Documents for DDX41 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX41 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...