Skip to main content

CARD8 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47527PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-47527PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CARD8.

Source: E. coli

Amino Acid Sequence: TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47527.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-47527PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: CARD8

TUCAN (also known as CARD8 and CARDINAL) is a CARD domain containing protein. TUCAN stands for tumor-up-regulated CARD-containing antagonist of caspase nine. Proteins containing a CARD (caspase-associated recruitment domain) domain are key regulators of cell death, cell survival and cytokine production (reviewed in Damiano and Reed, 2004). CARD domains are found in the N-terminal pro-domains of certain caspases, a family of apoptotic and pro-inflammatory proteases, as well as in a diversity of other proteins including TUCAN. CARD domains are homotypic protein interaction motifs that enable networks of proteins to communicate via CARD-CARD interactions. TUCAN is an anti-apoptotic CARD protein that can protect tumors from cell death stimuli, and is overexpressed in certain forms of cancer. The role of TUCAN in tumor biology remains to be fully elucidated, and there appears to be be various mechanisms by TUCAN can potentially contribute to apoptosis resistance (reviewed in Checinska et al, 2006). For example, TUCAN has been shown to inhibit caspase-9 activation by binding to the CARD region of pro-caspase-9, thereby suppressing the formation of the Apaf-1-caspase-9 apoptotic complex and apoptosis. Additionally, a TUCAN isoform has been described that blocks both caspase-8 and caspase-9 mediated apoptosis. However, in some tumors, TUCAN does not appear to interact with caspase-9 and may play a role in modulating NF-kB transcription factor survivial signaling pathways. In this regard a CARD-independent interaction of TUCAN with Ikkg has been described, resulting in the inhibition of interleukin-1 and TNF-induced NF-kB activation. Human TUCAN is a 431 amino acid protein according to GenBank no. gi|14424229|sp|Q9Y2G2|CARD8_HUMAN, and migrates at ~45-49 kDa on SDS-PAGE.

Alternate Names

Apoptotic protein NDPP1, CARD inhibitor of NF-kappaB-activating ligands, CARDINALFLJ18121, CARD-inhibitor of NF-kappa-B-activating ligand, caspase recruitment domain family, member 8, caspase recruitment domain-containing protein 8, DACAR, Dakar, KIAA0955DKFZp779L0366, NDPP, NDPP1MGC57162, TUCANFLJ18119, Tumor up-regulated CARD-containing antagonist of CASP9, tumor up-regulated CARD-containing antagonist of caspase nine

Gene Symbol

CARD8

Additional CARD8 Products

Product Documents for CARD8 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for CARD8 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...