Skip to main content

Recombinant Human ARNT2 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00009915-P02

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00009915-P02-25ug
H00009915-P02-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-217 of Human ARNT2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPSKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLREQLCTSENSMTGQWSSLYEAV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

50.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ARNT2 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00009915-P02
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: ARNT2

This gene encodes a member of the basic-helix-loop-helix-Per-Arnt-Sim (bHLH-PAS) superfamily of transcription factors. The encoded protein acts as a partner for several sensor proteins of the bHLH-PAS family, forming heterodimers with the sensor proteins that bind regulatory DNA sequences in genes responsive to developmental and environmental stimuli. Under hypoxic conditions, the encoded protein complexes with hypoxia-inducible factor 1alpha in the nucleus and this complex binds to hypoxia-responsive elements in enhancers and promoters of oxygen-responsive genes. A highly similar protein in mouse forms functional complexes with both aryl hydrocarbon receptors and Single-minded proteins, suggesting addition roles for the encoded protein in the metabolism of xenobiotic compounds and the regulation of neurogenesis, respectively. [provided by RefSeq]

Alternate Names

ARNT protein 2, aryl-hydrocarbon receptor nuclear translocator 2, bHLHe1BHLHE1, Class E basic helix-loop-helix protein 1, KIAA0307aryl hydrocarbon receptor nuclear translocator 2

Gene Symbol

ARNT2

Additional ARNT2 Products

Product Documents for Recombinant Human ARNT2 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human ARNT2 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...