Recombinant Human ALG13 GST (N-Term) Protein

Name: Recombinant Human ALG13 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00079868-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00079868-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

View all ALG13 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-165 of Human ALG13

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

44.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ALG13 GST (N-Term) Protein

SDS-PAGE: Recombinant Human ALG13 GST (N-Term) Protein [H00079868-P01]

SDS-Page: Recombinant Human ALG13 Protein [H00079868-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00079868-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: ALG13

The protein encoded by the ALG13 gene is a subunit of a bipartite UDP-N-acetylglucosamine transferase. It heterodimerizeswith asparagine-linked glycosylation 14 homolog to form a functional UDP-GlcNAc glycosyltransferase that catalyzes thesecond sugar addition of the highly conserved oligosaccharide precursor in endoplasmic reticulum N-linkedglycosylation. Multiple transcript variants encoding different isoforms have been found for this gene. (provided byRefSeq)

Alternate Names

Asparagine-linked glycosylation 13 homolog, asparagine-linked glycosylation 13 homolog (S. cerevisiae), chromosome X open reading frame 45, CXorf45, EC 2.4.1.141, FLJ23018, FLJ31785, GLT28D1, glycosyltransferase 28 domain containing 1, Glycosyltransferase 28 domain-containing protein 1, hematopoietic stem/progenitor cells protein MDS031, MDS031, MGC12423, UDP-N-acetylglucosamine transferase subunit ALG13 homolog, YGL047W

Gene Symbol

ALG13

Additional ALG13 Products

Product Documents for Recombinant Human ALG13 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human ALG13 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews