Skip to main content

Recombinant Human ADAMTS18 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00170692-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00170692-Q01-10ug
H00170692-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 942-1047 of Human ADAMTS18

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TCSKACAGGQQSRKIQCVQKKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKGSAAETLPESQCTSLPRPELQEGCVLGR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human ADAMTS18 GST (N-Term) Protein

SDS-PAGE: Recombinant Human ADAMTS18 GST (N-Term) Protein [H00170692-Q01]

SDS-PAGE: Recombinant Human ADAMTS18 GST (N-Term) Protein [H00170692-Q01]

SDS-Page: Recombinant Human ADAMTS18 Protein [H00170692-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00170692-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: ADAMTS18

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by gene ADAMTS16, another family member. It is thought to function as a tumor suppressor. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined. [provided by RefSeq]

Alternate Names

A disintegrin and metalloproteinase with thrombospondin motifs 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 18, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 21, ADAM metallopeptidase with thrombospondin type 1 motif, 18, ADAM-TS 18, ADAM-TS18, ADAMTS-18, ADAMTS21, disintegrin and metalloprotease-like protein, EC 3.4.24.-, EC 3.4.24.82

Gene Symbol

ADAMTS18

Additional ADAMTS18 Products

Product Documents for Recombinant Human ADAMTS18 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human ADAMTS18 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...