ZNF148 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-88646

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-88646
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

View all ZNF148 Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF148. Peptide sequence: RCAIKGGLLTSEEDSGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit ZNF148 Antibody - BSA Free (NBP2-88646) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ZNF148 Antibody - BSA Free

Western Blot: ZNF148 Antibody [NBP2-88646]

Western Blot: ZNF148 Antibody [NBP2-88646]

Western Blot: ZNF148 Antibody [NBP2-88646] - WB Suggested Anti-ZNF148 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: OVCAR-3 cell lysateZNF148 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells
Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-88646]

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-88646]

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-88646] - Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Applications for ZNF148 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF148

ZBP-89, also known as BFCOL1, BERF1 and ZNF 148, is a zinc finger transcription factor that is universally expressed. ZBP-89, a Kruppel-like repressor protein, is the silencer element binding factor for Vimentin. ZBP-89 has been shown to bind to GC-rich DNA elements in promoters for gastrin, ornithine decarboxylase and the cyclin-dependent kinase inhibitor p21 (also designated Cip1 or WAF1). ZBP-89 expression is induced by trans-retinoic acid or butyrate, which also induces terminal differentiation of colon cancer cells. ZBP-89 cooperates with histone acetyltransferase coactivator p300 in the regulation of p21, a cyclin-dependent kinase inhibitor whose associated gene is a target gene of p53. ZBP-89 also regulates cell proliferation, in part, through its ability to directly bind the p53 protein and retard its nuclear export. Elevated levels of ZBP-89 induce growth arrest and apoptosis in human gastrointestinal cells.

Alternate Names

BERF-1, BFCOL1, CACCC box-binding protein, CLL-associated antigen KW-10, HT-BETA, pHZ-52, Transcription factor ZBP-89, ZBP89, ZBP-89, ZFP148zinc finger protein 148 (pHZ-52), Zinc finger DNA-binding protein 89, zinc finger protein 148

Gene Symbol

ZNF148

Additional ZNF148 Products

Product Documents for ZNF148 Antibody - BSA Free

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ZNF148 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.