PMM2/Phosphomannomutase 2 Antibody [Janelia Fluor® 549]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38068JF549

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Janelia Fluor 549

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all PMM2/Phosphomannomutase 2 Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human PMM2/Phosphomannomutase 2 (NP_000294.1).

Sequence:
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for PMM2/Phosphomannomutase 2 Antibody [Janelia Fluor® 549]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: PMM2/Phosphomannomutase 2

PMM2, also known as Phosphomannomutase 2, is a 246 amino acid protein that is 28 kDa, catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Studies are being performed on the relationship of this protein to congenital disorder of glycosylation, hydrops fetalis, premature ovarian failure, cerebellar hypoplasia, metabolic disorders, alcohol abuse, intellectual disability, hypertrophic cardiomyopathy, cerebellar ataxia, galactosemia, peripheral neuropathy, hypogonadism, neuropathy, hypotonia, cardiomyopathy, thrombocytopenia, ataxia, alcoholism, and malaria. The PMM2 protein has also shown an interaction with HIST1H4A, HIST1H4B, HIST1H4D, HIST1H4E, HIST1H4C, and over 130 other proteins in synthesis of substrates in N-glycan biosynthesis, asparagine N-linked glycosylation, metabolism of proteins, post-translational protein modification, biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, fructose and mannose metabolism, amino sugar and nucleotide sugar metabolism, GDP-mannose biosynthesis, and colanic acid building blocks biosynthesis pathways.

Alternate Names

CDG1, CDG1A, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2

Gene Symbol

PMM2

Additional PMM2/Phosphomannomutase 2 Products

Product Documents for PMM2/Phosphomannomutase 2 Antibody [Janelia Fluor® 549]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for PMM2/Phosphomannomutase 2 Antibody [Janelia Fluor® 549]



Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.