Skip to main content

PMM2/Phosphomannomutase 2 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38068

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human PMM2/Phosphomannomutase 2 (NP_000294.1).

Sequence:
MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for PMM2/Phosphomannomutase 2 Antibody - BSA Free

PMM2/Phosphomannomutase 2 Antibody

Immunocytochemistry/ Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP3-38068] -

Immunocytochemistry/ Immunofluorescence: PMM2/Phosphomannomutase 2 Antibody [NBP3-38068] - Immunofluorescence analysis of L929 cells using PMM2/Phosphomannomutase 2 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
PMM2/Phosphomannomutase 2 Antibody

Western Blot: PMM2/Phosphomannomutase 2 Antibody [NBP3-38068] -

Western Blot: PMM2/Phosphomannomutase 2 Antibody [NBP3-38068] - Western blot analysis of various lysates using PMM2/Phosphomannomutase 2 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.

Applications for PMM2/Phosphomannomutase 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: PMM2/Phosphomannomutase 2

PMM2, also known as Phosphomannomutase 2, is a 246 amino acid protein that is 28 kDa, catalyzes the isomerization of mannose 6-phosphate to mannose 1-phosphate, which is a precursor to GDP-mannose necessary for the synthesis of dolichol-P-oligosaccharides. Studies are being performed on the relationship of this protein to congenital disorder of glycosylation, hydrops fetalis, premature ovarian failure, cerebellar hypoplasia, metabolic disorders, alcohol abuse, intellectual disability, hypertrophic cardiomyopathy, cerebellar ataxia, galactosemia, peripheral neuropathy, hypogonadism, neuropathy, hypotonia, cardiomyopathy, thrombocytopenia, ataxia, alcoholism, and malaria. The PMM2 protein has also shown an interaction with HIST1H4A, HIST1H4B, HIST1H4D, HIST1H4E, HIST1H4C, and over 130 other proteins in synthesis of substrates in N-glycan biosynthesis, asparagine N-linked glycosylation, metabolism of proteins, post-translational protein modification, biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein, fructose and mannose metabolism, amino sugar and nucleotide sugar metabolism, GDP-mannose biosynthesis, and colanic acid building blocks biosynthesis pathways.

Alternate Names

CDG1, CDG1A, CDGS, EC 5.4.2.8, phosphomannomutase 2, PMM 2

Gene Symbol

PMM2

Additional PMM2/Phosphomannomutase 2 Products

Product Documents for PMM2/Phosphomannomutase 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PMM2/Phosphomannomutase 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...