Skip to main content

HOP Antibody [Janelia Fluor® 525]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35571JF525

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Janelia Fluor 525

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human HOP (NP_631957.1).

Sequence:
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for HOP Antibody [Janelia Fluor® 525]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: HOP

HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.

Alternate Names

CAMEO, HOD, homeodomain-only protein, HOP homeobox, HOPLAGYNECC1OB1SMAP31, Lung cancer-associated Y protein, MGC20820, not expressed in choriocarcinoma clone 1, Not expressed in choriocarcinoma protein 1, odd homeobox 1 protein, Odd homeobox protein 1, TOTO

Gene Symbol

HOPX

Additional HOP Products

Product Documents for HOP Antibody [Janelia Fluor® 525]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HOP Antibody [Janelia Fluor® 525]



Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...