Skip to main content

HOP Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35571

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-35571-20ul
NBP3-35571-100ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-73 of human HOP (NP_631957.1).

Sequence:
MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit HOP Antibody - BSA Free (NBP3-35571) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HOP Antibody - BSA Free

HOP Antibody

Western Blot: HOP Antibody [NBP3-35571] -

Western Blot: HOP Antibody [NBP3-35571] - Western blot analysis of lysates from Rat heart, using HOP Rabbit pAb at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 180s.
HOP Antibody

Immunocytochemistry/ Immunofluorescence: HOP Antibody [NBP3-35571] -

Immunocytochemistry/ Immunofluorescence: HOP Antibody [NBP3-35571] - Immunofluorescence analysis of paraffin-embedded Human skin using HOP Rabbit pAbat a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
HOP Antibody - BSA Free

HOP Antibody [NBP3-35571] -

Analysis of various lysates using HOPX Rabbit PolymAb® at 1:10000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 15s.

Applications for HOP Antibody - BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HOP

HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.

Alternate Names

CAMEO, HOD, homeodomain-only protein, HOP homeobox, HOPLAGYNECC1OB1SMAP31, Lung cancer-associated Y protein, MGC20820, not expressed in choriocarcinoma clone 1, Not expressed in choriocarcinoma protein 1, odd homeobox 1 protein, Odd homeobox protein 1, TOTO

Gene Symbol

HOPX

Additional HOP Products

Product Documents for HOP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HOP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...