Skip to main content

ERK1/2 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05645

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-05645

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK1/2 (NP_620407.1/NP_002737.2). LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit ERK1/2 Antibody - Azide and BSA Free (NBP3-05645) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for ERK1/2 Antibody - Azide and BSA Free

Western Blot: ERK1/2 AntibodyAzide and BSA Free [NBP3-05645]

Western Blot: ERK1/2 AntibodyAzide and BSA Free [NBP3-05645]

Western Blot: ERK1/2 Antibody [NBP3-05645] - Western blot analysis of extracts of various cell lines, using ERK1/2 antibody (NBP3-05645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
ERK1/2 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody - Azide and BSA Free [NBP3-05645] -

Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody - Azide and BSA Free [NBP3-05645] - Confocal immunofluorescence analysis of Hela cells using ERK1/2 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody - Azide and BSA Free [NBP3-05645]

Immunocytochemistry/ Immunofluorescence: ERK1/2 Antibody - Azide and BSA Free [NBP3-05645]

Immunocytochemistry/Immunofluorescence: ERK1/2 Antibody [NBP3-05645] - Immunofluorescence analysis of NIH-3T3 cells using ERK1/2 Polyclonal Antibody (NBP3-05645) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for ERK1/2 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:100 - 1:200

Western Blot

1:1000 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ERK1/2

The extracellular signal-regulated kinases 1 and 2 (ERK1 and ERK2), also called p44 and p42 MAP kinases, are members of the Mitogen Activated Protein Kinase (MAPK) family of proteins found in all eukaryotes. Because the 44 kDa ERK1 and the 42 kDa ERK2 are highly homologous and both function in the same protein kinase cascade, the two proteins are often referred to collectively as ERK1/2 or p44/p42 MAP kinase (1). They are both located in the cytosol and mitochondria (2). While the role of cytosol ERK1/2 is well studied and involved in multiple cellular functions (2), the role of mitochondrial ERK1/2 remains poorly understood. Both ERK 1 and 2 are activated by MEK1 or MEK2, by dual phosphorylation of a threonine and tyrosine residue in the activation loop (TEY motif) (1, 3). Either phosphorylation alone can induce an electrophoretic mobility shift, but both are required for activation of the kinase. This dual phosphorylation is efficiently detected by phosphorylation state-specific antibody directed to the pTEpY motif. Once activated, MAP kinases phosphorylate a broad spectrum of substrates, including cytoskeletal proteins, translation regulators, transcription factors, and the Rsk family of protein kinases (4). ERK1/2 activation is generally thought to confer a survival advantage to cells (5); however there is increasing evidence that suggests that the activation of ERK1/2 also contributes to cell death under certain conditions (5). ERK1/2 also is activated in neuronal and renal epithelial cells upon exposure to oxidative stress and toxicants or deprivation of growth factors, and inhibition of the ERK pathway blocks apoptosis (5).

Alternate Names

EC 2.7.11, ERK-1, ERK1p44-MAPK, ERT2, Extracellular signal-regulated kinase 1, extracellular signal-related kinase 1, HS44KDAP, HUMKER1A, Insulin-stimulated MAP2 kinase, MAP kinase 1, MAP kinase 3, MAP kinase isoform p44, MAPK 1, MAPK 3, MGC20180, Microtubule-associated protein 2 kinase, Mitogen-activated protein kinase 1, mitogen-activated protein kinase 3, p44erk1, p44-ERK1, P44MAPK, PRKM3EC 2.7.11.24

Gene Symbol

MAPK3

Additional ERK1/2 Products

Product Documents for ERK1/2 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for ERK1/2 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov