Skip to main content

Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35061

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-35061-100ul
NBP3-35061-20ul

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3C1Q3

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Adenine Nucleotide Translocase 1 (NP_001142.2).

Sequence:
LGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

Novus Biologicals Rabbit Adenine Nucleotide Translocase 1 Antibody (3C1Q3) (NBP3-35061) is a monoclonal antibody validated for use in WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Immunoprecipitation: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] -

Immunoprecipitation: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Immunoprecipitation analysis of 300 ug extracts of 293T cells using 3 ug Adenine Nucleotide Translocase 1 antibody. Western blot was performed from the immunoprecipitate using Adenine Nucleotide Translocase 1 antibody at a dilution of 1:1000.
Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] -

Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Western blot analysis of various lysates using [KO Validated] Adenine Nucleotide Translocase 1 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] -

Western Blot: Adenine Nucleotide Translocase 1 Antibody (3C1Q3) [NBP3-35061] - Western blot analysis of lysates from MCF7 cells, using [KO Validated] Adenine Nucleotide Translocase 1 Rabbit mAb at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenine Nucleotide Translocase 1

Adenine Nucleotide Translocase 1 (ANT1) catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It is is a key component of the mitochondrial permeability transition pore (PT pore) complex and is also one of the most abundant proteins in the mitochondrion making up approximately 10% of all mitochondrial proteins. Originally described as an ADP/ATP exchange factor, ANT1 has also been shown to be required for bax mediated apoptosis. This is effected by binding of bax to residues 105-156 of ANT1, presumably resulting in maintaining the PT pore in an open conformation. Interaction with bax is not required for ANT1 pro-apoptotic activity as overexpression of the ANT1 protein also leads to the induction of apoptosis.

Alternate Names

AAC1, Adenine nucleotide translocator 1, ADP, ADP/ATP translocase 1, ANT 1, ANT1adenine nucleotide translocator 1 (skeletal muscle), ATP carrier protein 1, ATP carrier protein, heart/skeletal muscle, ATP carrier protein, heart/skeletal muscle isoform T1, heart/skeletal muscle ATP/ADP translocator, PEO2, PEO3, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 4, Solute carrier family 25 member 4, T1ANT

Gene Symbol

SLC25A4

Additional Adenine Nucleotide Translocase 1 Products

Product Documents for Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adenine Nucleotide Translocase 1 Antibody (3C1Q3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...