Skip to main content

Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-05640

Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-05640-100ul
NBP3-05640-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ANT1 (NP_001142.2). GMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

Western Blot: Adenine Nucleotide Translocase 1/2/3/4 AntibodyAzide and BSA Free [NBP3-05640]

Western Blot: Adenine Nucleotide Translocase 1/2/3/4 AntibodyAzide and BSA Free [NBP3-05640]

Western Blot: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Analysis of extracts of various cell lines, using ANT1/ANT2/ANT3/ANT4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 150s.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]

Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]

Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb (NBP3-05640) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]

Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free [NBP3-05640]

Immunohistochemistry-Paraffin: Adenine Nucleotide Translocase 1/2/3/4 Antibody [NBP3-05640] - Immunohistochemistry of paraffin-embedded Mouse kidney using Adenine Nucleotide Translocase 1/2/3/4 Rabbit pAb (NBP3-05640) at dilution of 1:50 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Adenine Nucleotide Translocase 1/2/3/4

Alternate Names

2F1, AAC1, AAC2, AAC3, AAC4, adenine nucleotide translocase 4, adenine nucleotide translocator 1 (skeletal muscle), adenine nucleotide translocator 2 (fibroblast), Adenine nucleotide translocator 3, Adenine nucleotide translocator 4, ADP,ATP carrier protein 1, ADP,ATP carrier protein 3, ADP,ATP carrier protein 4, ADP,ATP carrier protein, fibroblast isoform, ADP,ATP carrier protein, heart/skeletal muscle, ADP,ATP carrier protein, isoform T2, ADP,ATP carrier protein, liver, ADP/ATP translocase 1, ADP/ATP translocase 2, ADP/ATP translocase 3, ADP/ATP translocase 4, ADP/ATP translocator of liver, ANT, ANT 1, ANT 2, ANT 3, ANT 4, ANT1, ANT2, ANT3, ANT3Y, ANT4, epididymis secretory sperm binding protein, heart/skeletal muscle ATP/ADP translocator, MTDPS12, MTDPS12A, PEO2, PEO3, PEOA2, SFEC35kDa, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6, Sperm flagellar energy carrier protein, T1, T2, T3

Gene Symbol

SLC25A4

Additional Adenine Nucleotide Translocase 1/2/3/4 Products

Product Documents for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Adenine Nucleotide Translocase 1/2/3/4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov