GLP-2 (human)

Name: GLP-2 (human)
Brand: Tocris Bioscience
SKU: 2258

Tocris Bioscience, part of Bio-Techne | Catalog # 2258

Citations (2)

COA / SDS

Endogenous hormone; displays intestinotrophic activity

Key Product Details

Description:	Endogenous hormone; displays intestinotrophic activity
Alternative Names:	Glucagon-like peptide 2 (human)
Purity:	≥95% (HPLC)
Molecular Weight:	3766.14

View Full Technical Details for GLP-2 (human)

Technical Data
Citations

Biological Activity for GLP-2 (human)

GLP-2 (human) is an endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.

GLP-2 (rat) also available.

Technical Data for GLP-2 (human)

M. Wt	3766.14
Formula	C₁₆₅H₂₅₄N₄₄O₅₅S
Single Letter Sequence	HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	223460-79-5
PubChem ID	90488756
InChi Key	JPRUMPQGPCFDGW-CWHSZFSPSA-N
Smiles	[H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for GLP-2 (human)

Solubility

Soluble to 1mg/ml in 5% NH4OH / water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for GLP-2 (human)

References are publications that support the biological activity of the product.

Brubaker and Drucker Glucagon-like peptides regulate cell proliferation and apoptosis in the pancreas, gut, and central nervous system. Endocrinol.
Bulut Glucagon-like peptide 2 improves intestinal wound healing through induction of epithelial cell migration in vitro-evidence for a TGF-β-mediated effect. Reg.Peptides
Rocha Glucagon-like peptide-2: divergent signalling pathways. J.Surg.Res. 2004 PMID: 15313368