Galanin (1-30) (human)

Name: Galanin (1-30) (human)
Brand: Tocris Bioscience
SKU: 1179

Tocris Bioscience, part of Bio-Techne | Catalog # 1179

Citations (6)

COA / SDS

Endogenous galanin receptor agonist

Key Product Details

Description:	Endogenous galanin receptor agonist
Purity:	≥95% (HPLC)
Molecular Weight:	3157.41

View Full Technical Details for Galanin (1-30) (human)

Technical Data
Citations

Biological Activity for Galanin (1-30) (human)

Galanin (1-30) (human) is a endogenous peptide with multiple endocrine, metabolic and behavioral effects. Has been shown to have an action on intestinal smooth muscle, insulin and somatostatin release, and synaptic neurotransmission.

Technical Data for Galanin (1-30) (human)

M. Wt	3157.41
Formula	C₁₃₉H₂₁₀N₄₂O₄₃
Single Letter Sequence	GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Storage	Store at -20°C
Purity	≥95% (HPLC)
CAS Number	119418-04-1
PubChem ID	16133823
InChi Key	CBSXZYWGVAQSHI-RUKUCZSXSA-N
Smiles	[H]NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility for Galanin (1-30) (human)

Solubility

Soluble to 0.5mg/ml in water

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Dilution Calculator

Calculate the dilution required to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration

References for Galanin (1-30) (human)

References are publications that support the biological activity of the product.

Schmidt Isolation and primary structure of pituitary human galanin, a 30-residue nonamidated neuropeptide. Proc.Natl.Acad.Sci.U.S.A. 1991 PMID: 1722333
Wang Hypothalamic galanin: control by signals of fat metabolism. Brain Res. 1998 PMID: 9729239
Niiro Mechanisms of galanin-induced contraction in the rat myometrium. Br.J.Pharmacol. 1998 PMID: 9756377