UBASH3B/STS1/Tula-2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-25213PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-25213PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all UBASH3B/STS1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human UBASH3B/STS1/Tula-2

Source: E.coli

Amino Acid Sequence: YGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGETTPLTIICQPM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25213It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-25213PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: UBASH3B/STS1

Sts-1 is a protein that inhibits endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. Sts-1 and Sts-2 (formerly p70 and Clip4, respectively) have been found to interact with Cbl, an ubiquitin ligase that plays a critical role in attenuation of receptor tyrosine kinase signaling by inducing ubiquitination and promoting their sorting for endosomal degradation. Sts-1 and Sts-2 contain SH3 domains that interact with Cbl, Ub-associated domains, which bind directly to mono-Ub or to the EGFR/Ub chimera, as well as phosphoglycerate mutase domains that mediate oligomerization of Sts-1/2. Sts-1 and Sts-2 also have been found to negatively regulate signaling pathways that control T cell receptors, which in turn affect the extent and duration of the T cell response to foreign pathogens.

Long Name

Ubiquitin Associated and SH3 Domain Containing Protein B

Alternate Names

Cbl-interacting Protein p70, STS1

Gene Symbol

UBASH3B

Additional UBASH3B/STS1 Products

Product Documents for UBASH3B/STS1/Tula-2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for UBASH3B/STS1/Tula-2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.