Skip to main content

Recombinant Human TBLR1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00079718-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00079718-P01-10ug
H00079718-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-102 of Human TBL1XR1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MQRYNFHYLKYIVHFYRTCDYSRMIRMVLAYGELLLLTVSAEILFQWTNIVAWQQMPTFCGIAANLQETLVGFSFCFLCFFPLLLNQQGWKEGREVMNYSFQ

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

38.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human TBLR1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00079718-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: TBLR1

The protein encoded by this gene has sequence similarity with members of the WD40 repeat-containing protein family. The WD40 group is a large family of proteins, which appear to have a regulatory function. It is believed that the WD40 repeats mediate protein-protein interactions and members of the family are involved in signal transduction, RNA processing, gene regulation, vesicular trafficking, cytoskeletal assembly and may play a role in the control of cytotypic differentiation. [provided by RefSeq]

Alternate Names

C21, DC42, F-box-like/WD repeat-containing protein TBL1XR1, FLJ12894, IRA1Transducin beta-like 1X-related protein 1, nuclear receptor co-repressor/HDAC3 complex subunit, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBLR1TBL1-related protein 1, transducin (beta)-like 1 X-linked receptor 1, transducin (beta)-like 1X-linked receptor 1

Gene Symbol

TBL1XR1

Additional TBLR1 Products

Product Documents for Recombinant Human TBLR1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human TBLR1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...