Recombinant Human STARD10 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00010809-P01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
Western Blot, ELISA, Affinity Purification, Microarray
Product Specifications
Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-291 of Human STARD10
Source: Wheat Germ (in vitro)
Amino Acid Sequence: MEKLAASTEPQGPRPVLGRESVQVPDDQDFRSFRSECEAEVGWNLTYSRAGVSVWVQAVEMDRTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTVNADVGYYSWRCPKPLKNRDVITLRSWLPMGADYIIMNYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGPKSCVITYLAQVDPKGSLPKWVVNKSSQFLAPKAMKKMYKACLKYPEWKQKHLPHFKPWLHPEQSPLPSLALSELSVQHADSLENIDESAVAESREERMGGAGGEGSDDDTSLT
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
59.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Protein / Peptide Type
Recombinant Protein
Scientific Data Images for Recombinant Human STARD10 GST (N-Term) Protein
12.5% SDS-PAGE Stained with Coomassie Blue.
Formulation, Preparation and Storage
H00010809-P01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: STARD10
STARD10 is broadly expressed in different organs and tissues such as the brain, endocrine tissues, liver, and gastrointestinal tract. STARD10 is regulated by Casein kinase II, which phosphorylates STARD10 at serine 284 leading to decreased lipid transfer activity and reduced membrane association. STARD10 is overexpressed in breast carcinoma cell lines and in primary breast cancers (3). STARD10 has been implicated in the regulation of bile acid homeostasis and more recently in the regulation of insulin secretion from beta-cells (1, 2, 4).
References
1. Alpy, F., & Tomasetto, C. (2005). Give lipids a START: The StAR-related lipid transfer (START) domain in mammals. Journal of Cell Science. https://doi.org/10.1242/jcs.02485
2. Alpy, F., Legueux, F., Tomasetto, C., & Bianchetti, L. (2009). START domain-containing proteins: A review of their role in lipid transport and exchange. Medecine/Sciences. https://doi.org/10.1051/medsci/2009252181
3. Olayioye, M. A., Hoffmann, P., Pomorski, T., Armes, J., Simpson, R. J., Kemp, B. E., ... Visvader, J. E. (2004). The phosphoprotein StarD10 is overexpressed in breast cancer and cooperates with ErbB receptors in cellular transformation. Cancer Research. https://doi.org/10.1158/0008-5472.CAN-03-3731
4. Carrat, G. R., Hu, M., Nguyen-Tu, M. S., Chabosseau, P., Gaulton, K. J., van de Bunt, M., ... Rutter, G. A. (2017). Decreased STARD10 Expression Is Associated with Defective Insulin Secretion in Humans and Mice. American Journal of Human Genetics. https://doi.org/10.1016/j.ajhg.2017.01.011
Long Name
StAR Related Lipid Transfer Domain Containing 10
Alternate Names
CGI-52, NY-CO-28, PCTP-L, PCTP2, SDCCAG28
Gene Symbol
STARD10
Additional STARD10 Products
Product Documents for Recombinant Human STARD10 GST (N-Term) Protein
Product Specific Notices for Recombinant Human STARD10 GST (N-Term) Protein
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...