Skip to main content

Pentraxin 3/TSG-14 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49595PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-49595PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Pentraxin 3/TSG-14.

Source: E. coli

Amino Acid Sequence: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49595.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49595PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Pentraxin 3/TSG-14

Pentraxin 3 (PTX3) is the prototypic member of the long pentraxin family sharing the C-terminal domain with short pentraxins (C-reactive protein and serum amyloid P component) and containing a unique N-terminal domain. The protein is a soluble pattern recognition receptor and represents a nonredundant component of the humoral innate immunity against selected pathogens. PTX3 is rapidly produced and released at inflammatory sites by diverse cell types including monocytes/macrophages, endothelial cells, vascular smooth muscle cells, fibroblasts, and adipocytes. It interacts with several ligands, including growth factors, extracellular matrix components and selected pathogens. PTX3 has been implicated in vascular damage, angiogenesis, atherosclerosis, and restenosis.

Long Name

Tumor Necrosis Factor Stimulated Gene 14

Alternate Names

PTX3, TSG-14, TSG14

Gene Symbol

PTX3

Additional Pentraxin 3/TSG-14 Products

Product Documents for Pentraxin 3/TSG-14 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Pentraxin 3/TSG-14 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...