Skip to main content

Recombinant Human p23/PTGES3 Protein

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-18323

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-18323-100ug
NBP3-18323-50ug

Key Product Details

Conjugate

Unconjugated

Applications

Western Blot, Functional Assay, SDS-PAGE

Product Specifications

Description

A recombinant protein corresponding to human p23/PTGES3.

Source: E. coli

Amino Acid Sequence: SHMQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Purity

>85%

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

4uM, when added to 2uMSPR-300 (Aha1)-activated HSP90 (2uM; His-tagged HSP90 beta) in 33mM Hepes pH7.2, 30mM NaCl, 5mM MgCl2, 1mM DTT, 1.5mM ATP in a 100ul reaction at 37 degrees C, eliminated all Aha1-mediated ATPaseStimulation as well as intrinsic HSP90 ATPase activity. (This is an enzyme-linked ATP regeneration assay tracking loss of NADH absorbance at 340nm).

Localization

Cytoplasm

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human p23/PTGES3 Protein

SDS-PAGE: Recombinant Human p23/PTGES3 Protein [NBP3-18323]

SDS-PAGE: Recombinant Human p23/PTGES3 Protein [NBP3-18323]

SDS-Page: Recombinant Human p23/PTGES3 Protein [NBP3-18323] - SDS-PAGE of native human 23kDa p23/PTGES3 protein (NBP3-18323).

Formulation, Preparation and Storage

NBP3-18323
Preparation Method This protein is affinity purified.
Formulation 20mM HEPES buffer pH7.2, 80mM NaCl, 10% glycerol
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: p23/PTGES3

Steroid receptors are ligand-dependent intracellular proteins that stimulate transcription of specific genes by binding to specific DNA sequences following activation by the appropriate hormone. Prior to activation, steroid receptors associate with a number of different proteins in both a stable and transient fashion. Steroid receptor complex proteins include heat shock proteins (HSP 70 and HSP 90), immunosuppressant binding proteins called immunophilins (the FK 506 binding proteins, FKBP 52 & FKBP 54 and the cyclosporin binding protein, CyP-40) and at least three other proteins termed p23, p60 and p48. p23 along with HSP 70, HSP 90 and p60, combine with progesterone receptor (PR) as members of a transient intermediate complex. Cloned human p23 encodes a protein of 160 amino acids that is highly conserved between species and shows no homology to previously identified proteins. p23 is a highly acidic phosphoprotein with an aspartic acid-rich C-terminal domain and multiple potential phosphorylation sites. In vitro studies have suggested that p23 binds to HSP90 and is necessary for the binding of HSP 90 and CyP-40 to PR. While neither its exact function nor mechanism of action have been identified, p23 appears to be an important factor in PR function.

Long Name

Prostaglandin E Synthase 3 (Cytosolic)

Alternate Names

CPGES, PTGES3, TEBP

Gene Symbol

PTGES3

Additional p23/PTGES3 Products

Product Documents for Recombinant Human p23/PTGES3 Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human p23/PTGES3 Protein

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...