Skip to main content

Recombinant Human NF2/Merlin GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00004771-P01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00004771-P01 has been discontinued. View all NF2/Merlin products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray, SDS-PAGE

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-82 of Human NF2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34.76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human NF2/Merlin GST (N-Term) Protein

SDS-PAGE: Recombinant Human NF2/Merlin GST (N-Term) Protein [H00004771-P01]

SDS-PAGE: Recombinant Human NF2/Merlin GST (N-Term) Protein [H00004771-P01]

SDS-Page: Recombinant Human NF2/Merlin Protein [H00004771-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004771-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: NF2/Merlin

Neurofibromin 2 (NF2) is a tumor suppressor gene encoding the protein Merlin. Merlin is closely related to the ERM (ezrin, radixin, moesin) family of proteins. The precise funtion of Merlin is not clear. It is thought to provide a link between the actin cytoskeleten and membrane associated proteins, playing a role in transduction of extracellular signals. It has been implicated in cell proliferation and cellular motility. Mutations in the NF2 gene cause neurofibromatosis type II, a condition characterised by the development of tumors in the central nervous system.

Long Name

Neurofibromin 2

Alternate Names

ACN, BANF, Merlin, SCH, Schwannomerlin, Schwannomin

Gene Symbol

NF2

Additional NF2/Merlin Products

Product Documents for Recombinant Human NF2/Merlin GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human NF2/Merlin GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...