Laminin Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-42389PEP
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: TVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVS
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP2-42389PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Laminin
Laminins are an important and biologically active part of the basal lamina, influencing cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis, where anti-laminin antibodies can be widely used to label blood vessels and basement membranes (1). Significant quantities of laminin are found in basement membranes, the thin extracellular matrices that surround epithelial tissue, nerve, fat cells and smooth, striated and cardiac muscle. Excessive serum laminin levels have been associated with fibrosis, cirrhosis and hepatitis, serious and frequent complications of chronic active liver disease characterized by excessive deposition of various normal components of connective tissue in liver (2). Epithelial mesenchymal transition (EMT) biomarkers include fibronectin, laminin, N-cadherin, and Slug (3).
References
1. Yang, M. Y., Chiao, M. T., Lee, H. T., Chen, C. M., Yang, Y. C., Shen, C. C., & Ma, H. I. (2015). An innovative three-dimensional gelatin foam culture system for improved study of glioblastoma stem cell behavior. J Biomed Mater Res B Appl Biomater, 103(3), 618-628. doi:10.1002/jbm.b.33214
2. Mak, K. M., & Mei, R. (2017). Basement Membrane Type IV Collagen and Laminin: An Overview of Their Biology and Value as Fibrosis Biomarkers of Liver Disease. Anat Rec (Hoboken), 300(8), 1371-1390. doi:10.1002/ar.23567
3. Choi, S., Yu, J., Park, A., Dubon, M. J., Do, J., Kim, Y., . . . Park, K. S. (2019). BMP-4 enhances epithelial mesenchymal transition and cancer stem cell properties of breast cancer cells via Notch signaling. Sci Rep, 9(1), 11724. doi:10.1038/s41598-019-48190-5
Alternate Names
Gene Symbol
Additional Laminin Products
Product Documents for Laminin Recombinant Protein Antigen
Product Specific Notices for Laminin Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.