Skip to main content

IL-17RE Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-93925PEP

Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-93925PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL17RE.

Source: E. coli

Amino Acid Sequence: EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSVRLCHQWALECEELSSPYDVQKIVSGGHTVELPYEFLLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDFWKSVHFTDYS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-93925.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-93925PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: IL-17RE

Interleukin-17 Receptor E (IL-17RE) is a transmembrane protein that is expressed on mucosal epithelial cells, keratinocytes, Th17 cells, and gamma delta T cells. It associates with IL-17RA to form a heterodimeric receptor for IL-17C. Binding of IL-17C to this receptor complex promotes mucosal immunity by stimulating the production of anti-bacterial peptides and pro-inflammatory cytokines and chemokines. Additionally, IL-17C signaling regulates Th17 cell-dependent immune responses and has been suggested to contribute to psoriatic skin thickening, the progression of arthritis, and the pathogenesis of autoimmune diseases.

Long Name

Interleukin 17 Receptor E

Alternate Names

IL-17 RE, IL17RE, Il25r

Gene Symbol

IL17RE

Additional IL-17RE Products

Product Documents for IL-17RE Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-17RE Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...