Skip to main content

Recombinant Human Host Cell Factor 1/HCFC1 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003054-Q01

Novus Biologicals, part of Bio-Techne
Discontinued Product
H00003054-Q01 has been discontinued. View all Host Cell Factor 1/HCFC1 products.

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 568-654 of Human Host Cell Factor 1/HCFC1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTIL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Partial Recombinant Protein

Scientific Data Images for Recombinant Human Host Cell Factor 1/HCFC1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003054-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Host Cell Factor 1/HCFC1

This gene is a member of the host cell factor family and encodes a protein with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possible sites, resulting in the creation of an N-terminal chain and the corresponding C-terminal chain. The final form of this protein consists of noncovalently bound N- and C-terminal chains. The protein is involved in control of the cell cycle and transcriptional regulation during herpes simplex virus infection. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq]

Alternate Names

C1 Factor, CFF, HCF1, HFC1

Gene Symbol

HCFC1

Additional Host Cell Factor 1/HCFC1 Products

Product Documents for Recombinant Human Host Cell Factor 1/HCFC1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Host Cell Factor 1/HCFC1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...