Skip to main content

Recombinant Human HLA DRB4 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00003126-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00003126-P01-25ug
H00003126-P01-10ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-237 of Human HLA-DRB4

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GDTQPRFLEQAKCECRFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

51.81 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human HLA DRB4 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00003126-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: HLA DRB4

HLA-DRB4( AAH05312, 30 a.a. - 267 a.a.) recombinant protein with GST.

Alternate Names

class II histocompatibility antigen HLA DR alpha, beta1-0307, DR12, DR-12, DR13, DR-13, DR14, DR-14, DR4, DR-4, DRB1 transplantation antigen, DRB4, HLA class II histocompatibility antigen, DR beta 4 chain, HLA class II histocompatibility antigen, DRB1-12 beta chain, HLA class II histocompatibility antigen, DRB1-4 beta chain, HLA-DR4B, human leucocyte antigen DRB4, leucocyte antigen DRB1, leukocyte antigen, major histocompatibility complex, class II, DR beta 1, major histocompatibility complex, class II, DR beta 4, MHC class I antigen DRB1*12, MHC class I antigen DRB1*4, MHC class II antigen DRB1*12, MHC class II antigen DRB1*13, MHC class II antigen DRB1*14, MHC class II antigen DRB1*4, MHC class II antigen DRB4, MHC class II antigen HLA-DRB1, MHC class II antigen HLA-DR-beta, MHC class II HLA-DR-beta-7, MHC class2 antigen, MHC HLA DR-beta chain

Gene Symbol

HLA-DRB4

Additional HLA DRB4 Products

Product Documents for Recombinant Human HLA DRB4 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human HLA DRB4 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...