HLA DOA Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-43684PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-43684PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all HLA DOA Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HLA DOA

Source: E.coli

Amino Acid Sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-43684It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-43684PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: HLA DOA

HLA DOA, also known as HLA class II histocompatibility antigen DO alpha chain, is a 250 amino acid protein that is 28 kDa, found in lysosomes in B cells and controls HLA-DM-mediated peptide loading on MHC class II molecules. Current research is being done on several diseases and disorders including vogt-koyanagi-harada disease, alopecia universalis, alopecia, systemic lupus erythematosus, graft versus host disease, lupus erythematosus, rheumatoid arthritis, toxoplasmosis, autoimmune thyroiditis, leishmaniasis, myocarditis, diabetes mellitus, arthritis influenza, immunodeficiency, asthma, tuberculosis, thyroiditis, interferon, and hepatitis b. Interactions with the HLA DOA protein have shown to involve ENSG00000204252 and HLA-DMA proteins in immune response antigen presentation by MHC class II, G-protein signaling N-RAS regulation pathway, immune response IL-22 signaling pathway, immune response NFAT in immune response, immune response ICOS pathway in T-helper cell, phagosome, cell adhesion molecules (CAMs), antigen processing and presentation, intestinal immune network for IgA production,and type I diabetes mellitus pathway.

Alternate Names

HLA class II histocompatibility antigen, DO alpha chain, HLA-D0-alpha, HLA-DNAHLADZ, HLA-DZA, lymphocyte antigen, major histocompatibility complex, class II, DN alpha, major histocompatibility complex, class II, DO alpha, MHC class II antigen DOA, MHC DN-alpha, MHC DZ alpha

Gene Symbol

HLA-DOA

Additional HLA DOA Products

Product Documents for HLA DOA Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for HLA DOA Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.