Skip to main content

GPIP137 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-57388PEP

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP2-57388PEP has been discontinued. View all GPIP137 products.

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPIP137.

Source: E. coli

Amino Acid Sequence: TIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57388.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-57388PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: GPIP137

GPIP137 may regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types

Alternate Names

activation/proliferation-associated protein 1, caprin 1, caprin-1, cell cycle associated protein 1, Cell cycle-associated protein 1, Cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-associated protein-1, GPI-anchored membrane protein 1GPIP137, GPI-p137, M11S1GPI-anchored protein p137, Membrane component chromosome 11 surface marker 1, membrane component, chromosome 11, surface marker 1, p137GPI, RNA granule protein 105, RNG105GPIAP1

Gene Symbol

CAPRIN1

Additional GPIP137 Products

Product Documents for GPIP137 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for GPIP137 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...