DPH2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-24798PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP3-24798PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Conjugate

Unconjugated

Applications

Antibody Competition

View all DPH2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DPH2

Source: E.coli

Amino Acid Sequence: DLGCERVALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGAQALIHFGPACLSPPARPLPVAFVLRQRSVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24798It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-24798PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: DPH2

DPH2 is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Two transcript variants encoding different isoforms have been found for this gene.

Alternate Names

diphthamide biosynthesis protein 2, Diphthamide biosynthesis protein 2 homolog-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2, diptheria toxin resistance protein required for diphthamide biosynthesis-like 2(S. cerevisiae), DPH2 homolog, DPH2 homolog (S. cerevisiae), DPH2L2diphthamide biosynthesis-like protein 2, DPH2-like 2, DPH2-like 2 (S. cerevisiae), HsDph2

Gene Symbol

DPH2

Additional DPH2 Products

Product Documents for DPH2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for DPH2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.