Collagen I alpha 1 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82489PEP
Key Product Details
Source
Tag
Conjugate
Applications
Product Specifications
Description
Source: E. coli
Amino Acid Sequence: NLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKDKRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLK
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Protein / Peptide Type
Formulation, Preparation and Storage
NBP1-82489PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: Collagen I alpha 1
Type I collagen is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon tissue. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue. Several collagens play a role in cell adhesion, responsible for maintaining normal tissue architecture and function. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Post-Golgi LH3 trafficking is essential for collagen homeostasis and for the development and function of multiple organs and tissues (1).
The COL1A1 gene encodes the pro-alpha1 chains of type I collagen protein, whose triple helix is comprised of two alpha1 chains and one alpha2 chain. Mutations in the encoding COL1A1 gene are associated with brittle bone disease (Osteogenesis Imperfecta), cortical hyperostosis (Caffey disease) and disorders that affect the connective tissues (Ehlers-Danlos syndrome) (2). Studies have found that HIF-1 transcription regulation of collagen prolyl hydroxylases regulates collagen deposition, promoting cancer cell alignment along collagen fibers, which enhances invasion and metastasis to lymph nodes and lung tissue by breast cancer cells (3).
References
1. Banushi, B., Forneris, F., Straatman-Iwanowska, A., Strange, A., Lyne, A. M., Rogerson, C., . . . Gissen, P. (2016). Regulation of post-Golgi LH3 trafficking is essential for collagen homeostasis. Nat Commun, 7, 12111. doi:10.1038/ncomms12111
2. Lu, Y., Zhang, S., Wang, Y., Ren, X., & Han, J. (2019). Molecular mechanisms and clinical manifestations of rare genetic disorders associated with type I collagen. Intractable Rare Dis Res, 8(2), 98-107. doi:10.5582/irdr.2019.01064
3. Gilkes, D. M., Chaturvedi, P., Bajpai, S., Wong, C. C., Wei, H., Pitcairn, S., . . . Semenza, G. L. (2013). Collagen prolyl hydroxylases are essential for breast cancer metastasis. Cancer Res, 73(11), 3285-3296. doi:10.1158/0008-5472.Can-12-3963
Alternate Names
Gene Symbol
Additional Collagen I alpha 1 Products
Product Documents for Collagen I alpha 1 Recombinant Protein Antigen
Product Specific Notices for Collagen I alpha 1 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.