I am looking for some c-fos antibodies that could work in IHC.

Name: Recombinant Human c-Fos GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00002353-P01

Here are a list of products which might be of interest to you: Product List. We have additional filters on the left which may help you narrow down based on host species, target species, clonality, etc. We will guarantee these to work for all stated species and applications listed on the datasheet.

Recombinant Human c-Fos GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00002353-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

Western Blot, ELISA, Affinity Purification, Microarray

View all c-Fos Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-380 of Human FOS

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

66.33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human c-Fos GST (N-Term) Protein

Recombinant Human c-Fos Protein [H00002353-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00002353-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: c-Fos

c-Fos is an intermediate early gene that is one of four members of the FOS family of activator protein-1 (AP-1) transcription factors, which also includes Fra-1, Fra-2, and FosB (1-3). Under the FOS gene, human c-Fos is synthesized as a protein of 308 amino acids (aa) with a basic leucine zipper (bZip) domain important for dimerization, and a basic domain for interacting with DNA, with a theoretical molecular weight of ~40.6 kDa (4,5). c-Fos can heterodimerize with members of the JUN family (c-Jun, JunB, and JunD) to form the active transcription factor AP-1 complex (3,5). AP-1 related proteins bind TPA-related responsive elements (TRE), cAMP responsive elements (CRE), and related sequences, with c-Fos:c-Jun dimers partial to TRE sites (5).

In response to stimuli, c-Fos, which is encoded by protooncogenes, has a role in cell proliferation, differentiation, and transformation (3,6). A variety of stimuli can increase c-Fos expression such as growth factors, proinflammatory cytokines, UV radiation, neurotransmitters, hormones, injury, and stress (1,6). c-Fos has long been used as a marker for neuronal activity and is associated with neural and behavioral responses following stimuli (1-3, 6-7). Mouse studies have revealed that c-Fos is important for efficient neurogenesis and cortical development (3). Additionally, c-Fos signal can be used as a molecular marker for learning and memory, such as recognition and fear (2,7). Studies have found that repeated positive stimuli result in increased Fos expression while, conversely, repeated negative value stimuli are indicated by decreased signal (7). Intermediate early genes have also been implicated in neuropsychiatric disorders including showing altered c-Fos expression in a schizophrenia animal model (2). Furthermore, antipsychotics and antidepressants are both capable of impacting c-Fos expression (2).

References

1. Kovacs K. J. (1998). c-Fos as a transcription factor: a stressful (re)view from a functional map. Neurochemistry International. https://doi.org/10.1016/s0197-0186(98)00023-0

2. Gallo, F. T., Katche, C., Morici, J. F., Medina, J. H., & Weisstaub, N. V. (2018). Immediate Early Genes, Memory and Psychiatric Disorders: Focus on c-Fos, Egr1 and Arc. Frontiers in Behavioral Neuroscience. https://doi.org/10.3389/fnbeh.2018.00079

3. Velazquez, F. N., Caputto, B. L., & Boussin, F. D. (2015). c-Fos importance for brain development. Aging. https://doi.org/10.18632/aging.100862

4. Uniprot (P01100)

5. Wu, Z., Nicoll, M., & Ingham, R. J. (2021). AP-1 family transcription factors: a diverse family of proteins that regulate varied cellular activities in classical hodgkin lymphoma and ALK+ ALCL. Experimental Hematology & Oncology. https://doi.org/10.1186/s40164-020-00197-9

6. Shaulian, E., & Karin, M. (2001). AP-1 in cell proliferation and survival. Oncogene. https://doi.org/10.1038/sj.onc.1204383

7. Chung L. (2015). A Brief Introduction to the Transduction of Neural Activity into Fos Signal. Development & Reproduction. https://doi.org/10.12717/DR.2015.19.2.061

Long Name

FBJ/Finkel–Biskis–Jinkins Murine Osteosarcoma Viral Oncogene Homolog

Alternate Names

cFos, FOS, G0S7

Gene Symbol

FOS

Additional c-Fos Products

Product Documents for Recombinant Human c-Fos GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human c-Fos GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews

Protocols
FAQs