VGLUT2 Antibody
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-94571
![Western Blot: VGLUT2 AntibodyAzide and BSA Free [NBP2-94571]](https://resources.bio-techne.com/images/products/VGLUT2-Antibody-Western-Blot-NBP2-94571-img0003.jpg "Western Blot: VGLUT2 AntibodyAzide and BSA Free [NBP2-94571]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500-582 of human VGLUT2 (NP_065079.1). GEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for VGLUT2 Antibody
Western Blot: VGLUT2 AntibodyAzide and BSA Free [NBP2-94571]
Western Blot: VGLUT2 Antibody [NBP2-94571] - Analysis of extracts of various cell lines, using VGLUT2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] -
Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] - Immunofluorescence analysis of rat brain using VGLUT2 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] -
Immunocytochemistry/ Immunofluorescence: VGLUT2 Antibody - Azide and BSA Free [NBP2-94571] - Immunofluorescence analysis of mouse brain using VGLUT2 Rabbit pAb (A15177) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for VGLUT2 Antibody
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: VGLUT2
Alternate Names
differentiation-associated BNPI, differentiation-associated Na(+)-dependent inorganic phosphate cotransporter, differentiation-associated Na-dependent inorganic phosphate cotransporter, DNPI, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6, solute carrier family 17 member 6, vesicular glutamate transporter 2, VGLUT2
Gene Symbol
SLC17A6
Additional VGLUT2 Products
Product Documents for VGLUT2 Antibody
Product Specific Notices for VGLUT2 Antibody
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...