Skip to main content

TRPC1 Antibody [Alexa Fluor® 750]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35247AF750

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP3-35247AF750 has been discontinued. View all TRPC1 products.

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Alexa Fluor 750 (Excitation = 749 nm, Emission = 775 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human TRPC1 (NP_001238774.1).

Sequence:
LLNLYSLVYNEDKKNTMGPALERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKFHDFADRKDWDAFHPTLVAEG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for TRPC1 Antibody [Alexa Fluor® 750]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: TRPC1

The TRP1 (TRPC1) gene encodes for a short transient receptor potential channel 1 protein which creates non-selective channels permeable to calcium and other cations. The long isoform is 793 amino acids long at around 91 kDA while the short isoform is 759 amino acids at approximately 87 kDA. These proteins are believed to be operated by a phosphatidylinositol messenger system. The TRP1 gene interacts with MX1, CAV1, ITPR3, HOMER1, and BMPR2 genes in pathways for CREB transcription, intracellular calcium signaling, developmental biology and pancreatic secretion. The TRP1 gene has been studied in various diseases such as kidney disease, breast cancer, neuroblastoma, prostatius, retinitis, basal cell carcinoma, muscular dystrophy, gingivitis, hypoxia, cerebritis, neurodegeneration, pyloric stenosis, and bipolar disorder.

Long Name

Short transient receptor potential channel 1

Alternate Names

TRP-1, TRP1

Gene Symbol

TRPC1

Additional TRPC1 Products

Product Documents for TRPC1 Antibody [Alexa Fluor® 750]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for TRPC1 Antibody [Alexa Fluor® 750]



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...