Skip to main content

Smad5 Antibody (1X5G9)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-33193

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-33193-20ul
NBP3-33193-100ul

Key Product Details

Species Reactivity

Human, Mouse

Applications

Western Blot, ELISA, Immunoprecipitation

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 1X5G9

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Smad5 (Q99717).

Sequence:
STYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Smad5 Antibody (1X5G9)

Smad5 Antibody (1X5G9)

Immunoprecipitation: Smad5 Antibody (1X5G9) [NBP3-33193] -

Immunoprecipitation: Smad5 Antibody (1X5G9) [NBP3-33193] - Immunoprecipitation analysis of 300 ug extracts of K-562 cells using 3 ug Smad5 antibody. Western blot was performed from the immunoprecipitate using Smad5 antibody at a dilution of 1:1000.
Smad5 Antibody (1X5G9)

Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] -

Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] - Western blot analysis of lysates from K-562 cells, using Smad5 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
Smad5 Antibody (1X5G9)

Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] -

Western Blot: Smad5 Antibody (1X5G9) [NBP3-33193] - Western blot analysis of lysates from C2C12 cells, using Smad5 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.

Applications for Smad5 Antibody (1X5G9)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunoprecipitation

0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells

Western Blot

1:1000 - 1:4000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Smad5

SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily (1). SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, SMAD2, SMAD5, SMAD8 and SMAD9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and SMAD7). SMAD1, SMAD5, SMAD8 and SMAD9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used as alternate names for one another in the literature. Human SMAD1 is a 465 amino acid protein; GenBank Accession No. AAP36050.1. Human SMAD2 is a 467 amino acid protein; GenBank Accession No. AAC51918.1 Human SMAD3 is a 425 amino acid protein; GenBank Accession No. NP_005893.1 Human SMAD4 is a 552 amino acid protein GenBank Accession No. NP_005350.1. Human SMAD5 is a 465 amino acid protein; GenBank Accession No. AAC50791.1. Human SMAD6 is a 496 amino acid protein; GenBank Accession No. AAH12986.1 Human SMAD7 is a 426 amino acid protein; GenBank Accession No. AAB81354.1 Mouse SMAD8 is a 430 amino acid protein; GenBank Accession No. AAN85445.1 Human SMAD9 is a 430 amino acid protein; GenBank Accession No. NP_005896.1.

Long Name

Mothers Against DPP Homolog 5

Alternate Names

Dwfc, JV5-1, MADH5

Gene Symbol

SMAD5

Additional Smad5 Products

Product Documents for Smad5 Antibody (1X5G9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Smad5 Antibody (1X5G9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...