Skip to main content

RPSA Antibody (2Q8Q6)

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-16624

Recombinant Monoclonal Antibody
Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-16624-100ul
NBP3-16624-20ul

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunocytochemistry/ Immunofluorescence, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2Q8Q6 expressed in HEK293

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865). EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit RPSA Antibody (2Q8Q6) (NBP3-16624) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for RPSA Antibody (2Q8Q6)

Western Blot: RPSA Antibody (2Q8Q6) [NBP3-16624]

Western Blot: RPSA Antibody (2Q8Q6) [NBP3-16624]

Western Blot: RPSA Antibody (2Q8Q6) [NBP3-16624] - Western blot analysis of extracts of various cell lines, using RPSA Rabbit mAb (NBP3-16624) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624]

Immunocytochemistry/ Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624]

Immunocytochemistry/Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624] - Immunofluorescence analysis of NIH-3T3 cells using RPSA Rabbit mAb (NBP3-16624) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
RPSA Antibody (2Q8Q6)

Immunocytochemistry/ Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624] -

Immunocytochemistry/ Immunofluorescence: RPSA Antibody (2Q8Q6) [NBP3-16624] - Confocal imaging of NIH/3T3 cells using RPSA Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for RPSA Antibody (2Q8Q6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: RPSA

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)

Alternate Names

37 kDa laminin receptor precursor, 37/67 kDa laminin receptor, 37LRPNEM/1CHD4, 67 kDa laminin receptor, 67kD, ribosomal protein SA, 67LR, Colon carcinoma laminin-binding protein, LAMBR37 kDa laminin receptor, laminin binding protein, Laminin receptor 1, laminin receptor 1 (67kD, ribosomal protein SA), Laminin-binding protein precursor p40, LamR, LAMR 1, LAMR140S ribosomal protein SA, LBP, LBP/p40, LRP, LRP/LR, Multidrug resistance-associated protein MGr1-Ag, p40, ribosomal protein SA

Gene Symbol

RPSA

Additional RPSA Products

Product Documents for RPSA Antibody (2Q8Q6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RPSA Antibody (2Q8Q6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...