Skip to main content

RPS10 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-98599

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-98599

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen for this antibody is RPS10 - C-terminal region. Peptide sequence PKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for RPS10 Antibody - BSA Free

Western Blot: RPS10 Antibody [NBP1-98599]

Western Blot: RPS10 Antibody [NBP1-98599]

Western Blot: RPS10 Antibody [NBP1-98599] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%
RPS10 Antibody - BSA Free

Western Blot: RPS10 Antibody - BSA Free [NBP1-98599] -

Core ribosomal protein RPS27A is lost from ribosomes after DSBs. (A) Western blots reveal that RPS27A is depleted in parental HEK cells after electroporation with Cas9‐sgIntron (sgJAK2) RNPs. HEK cells harvested 72 h post dCas9‐sgIntron electroporation served as the negative control. (B) Western blots depict loss of Cas9 protein after Cas9‐sgIntron electroporation. (C) T7 endonuclease 1 (T7E1) assay of JAK2 editing after Cas9‐sgIntron electroporation. Band intensities were calculated using imagej, and percent edited was calculated as 100% × (1 − (1 − fraction cleaved)1/2), where fraction cleaved = (sum of cleavage product intensities)/(sum of uncleaved and cleaved product intensities). (D) Genome editing does not affect JAK2 mRNA abundance. Fold changes were calculated using the2‐ delta deltaCt method with Cas9 without sgIntron (apo Cas9) as the control and GAPDH as the reference gene (n = 3, error bars = standard deviation, P > 0.05, one‐way ANOVA). (E) Western blots show that RPS27A is depleted after DNA DSBs but not after other forms of DNA damage. MMS: methyl methanesulfonate, 0.03%, 1 h. Cas9: Cas9‐sgIntron electroporation, 72 h recovery. H2O2: 500 μm hydrogen peroxide, 1 h. UV: UV irradiation, 20 J·m−2, 6 h recovery. HU: hydroxyurea, 10 mm, 16 h. Etoposide: 5 μm, 16 h. Doxorubicin: 10 μm, 16 h. (F, G) Polysome profiles and western blots of polysome profiling fractions from HEK cells treated with (F) DMSO or (G) 5 μm etoposide for 16 h reveal that RPS27A is lost from ribosomes after DSBs. UV absorbance = UV absorbance at 254 nm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34914197), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for RPS10 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: RPS10

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S10E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternate splicing results in multiple transcript variants that encode the same protein. Naturally occurring read-through transcription occurs between this locus and the neighboring locus NUDT3 (nudix (nucleoside diphosphate linked moiety X)-type motif 3).

Alternate Names

DBA9,40S ribosomal protein S10, MGC88819, ribosomal protein S10

Gene Symbol

RPS10

Additional RPS10 Products

Product Documents for RPS10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RPS10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...