RPS10 Antibody - BSA Free
Novus Biologicals, part of Bio-Techne | Catalog # NBP1-98599
Key Product Details
Species Reactivity
Human
Applications
Validated:
Western Blot
Cited:
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Concentration
0.5 mg/ml
Product Specifications
Immunogen
The immunogen for this antibody is RPS10 - C-terminal region. Peptide sequence PKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGG. The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for RPS10 Antibody - BSA Free
Western Blot: RPS10 Antibody [NBP1-98599]
Western Blot: RPS10 Antibody [NBP1-98599] - Jurkat Cell Lysate 1.0ug/ml, Gel Concentration: 10-20%Western Blot: RPS10 Antibody - BSA Free [NBP1-98599] -
Core ribosomal protein RPS27A is lost from ribosomes after DSBs. (A) Western blots reveal that RPS27A is depleted in parental HEK cells after electroporation with Cas9‐sgIntron (sgJAK2) RNPs. HEK cells harvested 72 h post dCas9‐sgIntron electroporation served as the negative control. (B) Western blots depict loss of Cas9 protein after Cas9‐sgIntron electroporation. (C) T7 endonuclease 1 (T7E1) assay of JAK2 editing after Cas9‐sgIntron electroporation. Band intensities were calculated using imagej, and percent edited was calculated as 100% × (1 − (1 − fraction cleaved)1/2), where fraction cleaved = (sum of cleavage product intensities)/(sum of uncleaved and cleaved product intensities). (D) Genome editing does not affect JAK2 mRNA abundance. Fold changes were calculated using the2‐ delta deltaCt method with Cas9 without sgIntron (apo Cas9) as the control and GAPDH as the reference gene (n = 3, error bars = standard deviation, P > 0.05, one‐way ANOVA). (E) Western blots show that RPS27A is depleted after DNA DSBs but not after other forms of DNA damage. MMS: methyl methanesulfonate, 0.03%, 1 h. Cas9: Cas9‐sgIntron electroporation, 72 h recovery. H2O2: 500 μm hydrogen peroxide, 1 h. UV: UV irradiation, 20 J·m−2, 6 h recovery. HU: hydroxyurea, 10 mm, 16 h. Etoposide: 5 μm, 16 h. Doxorubicin: 10 μm, 16 h. (F, G) Polysome profiles and western blots of polysome profiling fractions from HEK cells treated with (F) DMSO or (G) 5 μm etoposide for 16 h reveal that RPS27A is lost from ribosomes after DSBs. UV absorbance = UV absorbance at 254 nm. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/34914197), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for RPS10 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: RPS10
Alternate Names
DBA9,40S ribosomal protein S10, MGC88819, ribosomal protein S10
Gene Symbol
RPS10
UniProt
Additional RPS10 Products
Product Documents for RPS10 Antibody - BSA Free
Product Specific Notices for RPS10 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...