Skip to main content

PSME4 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-85552

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP2-85552 has been discontinued. View all PSME4 products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free

Concentration

0.5 mg/ml

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human PSME4. Peptide sequence: WMPQLLMNLSAHLNDPQPIEMTVKKTLSNFRRTHHDNWQEHKQQFTDDQL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Description

Novus Biologicals Rabbit PSME4 Antibody - BSA Free (NBP2-85552) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for PSME4 Antibody - BSA Free

Western Blot: PSME4 Antibody [NBP2-85552]

Western Blot: PSME4 Antibody [NBP2-85552]

Western Blot: PSME4 Antibody [NBP2-85552] - Host: Rabbit. Target Name: PSME4. Sample Tissue: Human HCT116 Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for PSME4 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: PSME4

Proteolytic degradation is critical to the maintenance of appropriate levels of short-lived and regulatory proteins as important and diverse as those involved in cellular metabolism, heat shock and stress response, antigen presentation, modulation of cell surface receptors and ion channels, cell cycle regulation, transcription, and signalling factors. The ubiquitin-proteasome pathway deconstructs most proteins in the eukaryotic cell cytosol and nucleus. Other proteins are degraded via the vacuolar pathway which includes endosomes, lysosomes, and the endoplasmic reticulum. The 26S proteasome is an ATP-dependent, multisubunit (~31), barrel-shaped molecular machine with an apparent molecular weight of ~2.5 MDa. It consists of a 20S proteolytic core complex which is crowned at one or both ends by 19S regulatory subunit complexes. The 19S regulatory subunits recognize ubiquitinated proteins and play an essential role in unfolding and translocating targets into the lumen of the 20S subunit. The PA28/11S REG Activator protein complex functions as a proteolytic activator. PA200 has been identified as a 200 kDa nuclear protein that activates the 26S proteasome complex. Studies have shown that, in human tissues, PA200 mRNA levels are highest in testis, but is also present in liver, spleen, brain, heart, kidney and lung. Evidence suggests that this protein is involved in DNA repair, possibly by recruiting the proteasome to double-strand DNA breaks.

Alternate Names

proteasome (prosome, macropain) activator subunit 4

Gene Symbol

PSME4

Additional PSME4 Products

Product Documents for PSME4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PSME4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...