Skip to main content

PPP2R1A Antibody [mFluor Violet 500 SE]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38186MFV500

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Western Blot

Label

mFluor Violet 500 SE (Excitation = 410 nm, Emission = 501 nm)

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PPP2R1A (NP_055040.2).

Sequence:
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for PPP2R1A Antibody [mFluor Violet 500 SE]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: PPP2R1A

PPP2R1A encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A.

Alternate Names

Medium tumor antigen-associated 61 kDa protein, MGC786, PP2A subunit A isoform PR65-alpha, PP2A subunit A isoform R1-alpha, PP2AAALPHA, PP2A-Aalpha, PR65A, protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), alphaisoform, protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform, protein phosphatase 2, regulatory subunit A, alpha, serine/threonine protein phosphatase 2A, 65 kDa regulatory subunit A, alphaisoform, serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alphaisoform

Gene Symbol

PPP2R1A

Additional PPP2R1A Products

Product Documents for PPP2R1A Antibody [mFluor Violet 500 SE]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PPP2R1A Antibody [mFluor Violet 500 SE]

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...