Skip to main content

Plasma Kallikrein/KLKB1 Antibody

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-58978

Novus Biologicals, part of Bio-Techne
Discontinued Product
NBP1-58978 has been discontinued. View all Plasma Kallikrein/KLKB1 products.

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Concentration

1 mg/ml

Product Specifications

Immunogen

Synthetic peptides corresponding to KLKB1(kallikrein B, plasma (Fletcher factor) 1) The peptide sequence was selected from the middle region of KLKB1. Peptide sequence VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Plasma Kallikrein/KLKB1 Antibody

Western Blot: Plasma Kallikrein/KLKB1 Antibody [NBP1-58978]

Western Blot: Plasma Kallikrein/KLKB1 Antibody [NBP1-58978]

Western Blot: Plasma Kallikrein 1B Antibody [NBP1-58978] - Human Liver cell lysate, concentration 2.5 ug/ml.

Applications for Plasma Kallikrein/KLKB1 Antibody

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Plasma Kallikrein/KLKB1

Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.Plasma prekallikrein is a glycoprotein that participates in the surface-dependent activation of blood coagulation, fibrinolysis, kinin generation and inflammation. It is synthesized in the liver and secreted into the blood as a single polypeptide chain. Plasma prekallikrein is converted to plasma kallikrein by factor XIIa by the cleavage of an internal Arg-Ile bond. Plasma kallikrein therefore is composed of a heavy chain and a light chain held together by a disulphide bond. The heavy chain originates from the amino-terminal end of the zymogen and contains 4 tandem repeats of 90 or 91 amino acids. Each repeat harbors a novel structure called the apple domain. The heavy chain is required for the surface-dependent pro-coagulant activity of plasma kallikrein. The light chain contains the active site or catalytic domain of the enzyme and is homologous to the trypsin family of serine proteases. Plasma prekallikrein deficiency causes a prolonged activated partial thromboplastin time in patients.

Alternate Names

KLKB1, Plasma Prekallikrein

Gene Symbol

KLKB1

UniProt

Additional Plasma Kallikrein/KLKB1 Products

Product Documents for Plasma Kallikrein/KLKB1 Antibody

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Plasma Kallikrein/KLKB1 Antibody

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...