Nup153 Antibody [Janelia Fluor® 669]

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-38586JF669

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Western Blot

Label

Janelia Fluor 669

Antibody Source

Polyclonal Rabbit IgG

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

View all Nup153 Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Nup153 (NP_005115.2).

Sequence:
FQAKREKVDSQYPPVQRLMTPKPVSIATNRSVYFKPSLTPSGEFRKTNQRIDNKCSTGYEKNMTPGQNREQRESGFSYPNFSLPAANGLSSGVGGGGGKMR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Applications for Nup153 Antibody [Janelia Fluor® 669]

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Nup153

Nuclear pore complexes are extremely elaborate structures that mediate the regulated movement of macromolecules between the nucleus and cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are pore complex specific glycoproteins characterized by cytoplasmically oriented O linked N acetylglucosamine residues and numerous repeats of the pentapeptide sequence XFXFG. Nup153 has three distinct domains: a N terminal region within which a pore targeting domain has been identified, a central region containing multiple zinc finger motifs, and a C terminal region containing multiple XFXFG repeats. Nup153 is a possible DNA binding subunit of the nuclear pore complex (NPC). The repeat containing domain may be involved in anchoring components of the pore complex to the pore membrane.

Alternate Names

CG4453, Dmel\CG4453, dmNup153, dNup153, HNUP153, N153, nuclear pore complex protein hnup153,153 kDa nucleoporin, nuclear pore complex protein Nup153, nucleoporin 153kD, nucleoporin 153kDa, Nucleoporin Nup153, Nup 153, NUP153, Nup153 Nucleoporin 153

Gene Symbol

NUP153

Additional Nup153 Products

Product Documents for Nup153 Antibody [Janelia Fluor® 669]

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Download SDS

Product Specific Notices for Nup153 Antibody [Janelia Fluor® 669]



Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.