Skip to main content

Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody - BSA Free

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-35614

Novus Biologicals, part of Bio-Techne

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

ELISA, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 23-230 of human Nicotinic Acetylcholine R alpha 7/CHRNA7 (NP_001177384.1).

Sequence:
ASPPSTPPWDPGHIPGASVRPAPGPVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody - BSA Free

Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Immunohistochemistry: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP3-35614] -

Immunohistochemistry: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP3-35614] - Immunohistochemistry analysis of paraffin-embedded Human placenta using Nicotinic Acetylcholine R alpha 7/CHRNA7 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP3-35614] -

Immunocytochemistry/ Immunofluorescence: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP3-35614] - Immunofluorescence analysis of L-929 cells using Nicotinic Acetylcholine R alpha 7/CHRNA7 Rabbit pAbat a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining.
Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP3-35614] -

Western Blot: Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody [NBP3-35614] - Western Blot analysis of lysates from MCF7 cells using Nicotinic Acetylcholine R alpha 7/CHRNA7 Rabbit pAbat 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25 ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 120s.

Applications for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Nicotinic Acetylcholine R alpha 7/CHRNA7

The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediatefast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits.The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conservedtransmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminalextracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeabilityto calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to,alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation thataffects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene islocated in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomallocation involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event inthis region results in a hybrid containing sequence from this gene and a novel FAM7A gene. (provided by RefSeq)

Long Name

Nicotinic Acetylcholine Receptor alpha 7

Alternate Names

CHRNA7, CHRNA7-2, Nicotinic Acetylcholine Ra 7

Gene Symbol

CHRNA7

Additional Nicotinic Acetylcholine R alpha 7/CHRNA7 Products

Product Documents for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...