Skip to main content

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry

Label

Biotin

Antibody Source

Monoclonal Mouse IgG2A Clone # 904032

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Product Specifications

Immunogen

Neuropeptide Y/NPY conjugated to KLH
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303

Specificity

Detects human Neuropeptide Y/NPY in direct ELISAs.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2A

Applications for Neuropeptide Y Antibody (904032) [Biotin]

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Formulation

PBS

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Neuropeptide Y/NPY

NPY a 36 amino acid peptide amide isolated from porcine brain, is a major regulatory neuropeptide in the mammalian central and peripheral nervous systems. NPY belongs to the pancreatic polypeptide family of peptides which are characterized by a common tertiary structure. Within this family, an intestinal peptide hormone, peptide YY (PYY), is most closely related to NPY. In the central nervous system (CNS) NPY is considered to be involved in regulation of blood pressure, memory processing, circadian rhythm, and stimulation of food intake. In the peripheral nervous system (PNS), NPY evokes potent vasoconstrictor activity and acts as a transmitter/neuromodulator of sympathetic neurons and adrenal glands. NPY is one of the most abundant peptides found in the CNS. NPY and NPY mRNA are widely distributed in the brain. High levels of NPY are present in the cerebral cortex, amygdaloid nuclei, hippocampal formation, and hypothalamus. In the PNS, NPY is widely distributed in sympathetic neurons that innervate vascular smooth muscle, heart, and urogenital tract. In these neurons NPY is mainly co-localized with norepinephrine and is considered to function as a neurotransmitter to presynaptically inhibit nor adrenergic neurotransmission. The biological actions of NPY in the brain and periphery are mediated by at least two different NPY receptors, designated Y1 and Y2 receptor subtypes. Cardiovascular effects and centrally evoked food intake potential are activities predominantly mediated by the Y1 receptors, whereas the Y2 receptors, the major subtype in the CNS, are mainly involved in the pre-synaptic inhibition of neurotransmitter release and facilitation of memory retention. Post-synaptic NPY receptors are apparently of both the Y1 and Y2 type. NPY receptors are coupled to at least two different signal transduction mechanisms, the adenylate cyclase pathway (decrease in cAMP), and the phosphoinositol/IP3 pathway. Antibodies that react specifically with NPY are useful for the study of the mode of action, differential tissue expression, and intracellular and subcellular localization of NPY in the central and peripheral nervous systems.

Alternate Names

NPY, PYY4

Gene Symbol

NPY

Additional Neuropeptide Y/NPY Products

Product Documents for Neuropeptide Y Antibody (904032) [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Neuropeptide Y Antibody (904032) [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...