Neuropeptide Y Antibody (904032) [Biotin]
Novus Biologicals, part of Bio-Techne | Catalog # FAB8517B
Conjugate
Catalog #
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry
Label
Biotin
Antibody Source
Monoclonal Mouse IgG2A Clone # 904032
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Product Specifications
Immunogen
Neuropeptide Y/NPY conjugated to KLH
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Accession # P01303
Specificity
Detects human Neuropeptide Y/NPY in direct ELISAs.
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2A
Applications for Neuropeptide Y Antibody (904032) [Biotin]
Application
Recommended Usage
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.
Formulation, Preparation, and Storage
Purification
Protein A or G purified from hybridoma culture supernatant
Formulation
PBS
Preservative
0.05% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C in the dark.
Background: Neuropeptide Y/NPY
Alternate Names
NPY, PYY4
Gene Symbol
NPY
Additional Neuropeptide Y/NPY Products
Product Documents for Neuropeptide Y Antibody (904032) [Biotin]
Product Specific Notices for Neuropeptide Y Antibody (904032) [Biotin]
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...